Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ DUSP10 Recombinant Protein

Abnova™ DUSP10 Recombinant Protein

Catalog No. 89012217 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
Catalog No. Quantity
89-012-217 10 μg
89-012-218 25 μg
2 options

Catalog No. 89-012-217

Supplier: Abnova™ H00011221P0110

Only null left
Add to Cart
Add to Cart

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number AAH20608
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 11221
Molecular Weight (g/mol) 41.14
Name DUSP10 (Human) Recombinant Protein (P01)
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Source Wheat Germ (in vitro)
Immunogen MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias MKP-5/MKP5
Common Name DUSP10
Gene Symbol DUSP10
Cross Reactivity Human
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Form Solution
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.