Dynactin Subunit 2/DCTN2/DCTN-50 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB406683	Novus Biologicals NBP18527725UL	25ul
NBP185277	Novus Biologicals NBP185277	0.1 mL

Description

Dynactin Subunit 2/DCTN2/DCTN-50 Polyclonal specifically detects Dynactin Subunit 2/DCTN2/DCTN-50 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: Dynactin Subunit 2/DCTN2/DCTN-50
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: DCTN-50, DCTN5050 kD dynein-associated polypeptide, dynactin 2 (p50), dynactin complex 50 kD subunit, Dynactin complex 50 kDa subunit, dynactin subunit 2,50 kDa dynein-associated polypeptide, DYNAMITIN, p50 dynamitin, RBP50
• Gene Symbols: DCTN2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human Dynactin Subunit 2/DCTN2/DCTN-50 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cell Cycle and Replication
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10540
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only