Abnova™ DYNC1H1 (Human) Recombinant Protein (P01)

Description

Human DYNC1H1 full-length ORF recombinant protein with GST-tag at N-terminal

Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains. This gene encodes a member of the cytoplasmic dynein heavy chain family.

• Theoretical MW (kDa): 48.6
• Preparation method: In vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 fast flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV

Best use within three months from the date of receipt of this protein.

ELISA, Western Blot (Recombinant protein), Antibody Production, Protein Array

Specifications

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Molecular Weight (g/mol): 48.6
• Name: Human DYNC1H1 Full-length ORF Recombinant Protein with GST-tag at N-terminal
• pH Range: 8
• Preparation Method: In vitro wheat germ expression system
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue
• Quantity: 2μg
• Source: Wheat Germ (in vitro)
• Storage Requirements: -80°C
• Cross Reactivity: Human
• Recombinant: Recombinant
• Form: Solution