Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
dynein, cytoplasmic 2, light intermediate chain 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23800825UL
Description
dynein, cytoplasmic 2, light intermediate chain 1 Polyclonal specifically detects dynein, cytoplasmic 2, light intermediate chain 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
dynein, cytoplasmic 2, light intermediate chain 1 | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Q8TCX1 | |
DYNC2LI1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CGI-60, cytoplasmic dynein 2 light intermediate chain 1, D2LICDKFZp564A033, DKFZP564A033, dynein, cytoplasmic 2, light intermediate chain 1, LIC3Dynein 2 light intermediate chain | |
Rabbit | |
Affinity Purified | |
RUO | |
51626 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction