Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dynein light chain 2a cytoplasmic Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310682100UL
Description
Dynein light chain 2a cytoplasmic Polyclonal specifically detects Dynein light chain 2a cytoplasmic in Human samples. It is validated for Western Blot.Specifications
Dynein light chain 2a cytoplasmic | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
BITH, Bithoraxoid-like protein, DNCL2Acytoplasmic dynein light chain 2A, DNLC2ABLP, Dynein light chain 2A, cytoplasmic, dynein light chain roadblock-type 1, dynein, cytoplasmic, light polypeptide 2A, dynein, light chain, roadblock-type 1, dynein-associated protein HKM23, Dynein-associated protein Km23, roadblock domain containing 1, Roadblock domain-containing protein 1, ROBL/LC7-like 1, ROBLD1Roadblock-1 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Dynein light chain 2a cytoplasmic (NP_054902). Peptide sequence VNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIR | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
83658 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction