Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dynein light chain 2a cytoplasmic Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Dynein light chain 2a cytoplasmic |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Dynein light chain 2a cytoplasmic Polyclonal specifically detects Dynein light chain 2a cytoplasmic in Human samples. It is validated for Western Blot.Specifications
Dynein light chain 2a cytoplasmic | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
BITH, Bithoraxoid-like protein, DNCL2Acytoplasmic dynein light chain 2A, DNLC2ABLP, Dynein light chain 2A, cytoplasmic, dynein light chain roadblock-type 1, dynein, cytoplasmic, light polypeptide 2A, dynein, light chain, roadblock-type 1, dynein-associated protein HKM23, Dynein-associated protein Km23, roadblock domain containing 1, Roadblock domain-containing protein 1, ROBL/LC7-like 1, ROBLD1Roadblock-1 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Dynein light chain 2a cytoplasmic (NP_054902). Peptide sequence VNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIR | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
83658 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title