Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DYSFIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DYSFIP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DYSFIP1 Polyclonal specifically detects DYSFIP1 in Human samples. It is validated for Western Blot.Specifications
DYSFIP1 | |
Polyclonal | |
Rabbit | |
Q86WC6 | |
116729 | |
Synthetic peptides corresponding to DYSFIP1(dysferlin interacting protein 1) The peptide sequence was selected from the middle region of DYSFIP1. Peptide sequence DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
dysferlin interacting protein 1, dysferlin interacting protein 1 (toonin), dysferlin-interacting protein 1, dysferlin-interacting protein 1 (toonin), MGC138299, toonin | |
PPP1R27 | |
IgG | |
17 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title