Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dystroglycan Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | Dystroglycan |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16901720
|
Novus Biologicals
NBP16901720UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP169017
|
Novus Biologicals
NBP169017 |
100 μL |
Each for $487.50
|
|
|||||
Description
Dystroglycan Polyclonal specifically detects Dystroglycan in Mouse samples. It is validated for Western Blot.Specifications
| Dystroglycan | |
| Polyclonal | |
| Rabbit | |
| Q62165 | |
| 1605 | |
| Synthetic peptides corresponding to Dag1 (dystroglycan 1) The peptide sequence was selected from the C terminal of Dag1. Peptide sequence PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A3a, AGRNR, DAG156DAG, dystroglycan, dystroglycan 1 (dystrophin-associated glycoprotein 1), Dystrophin-associated glycoprotein 1 | |
| DAG1 | |
| IgG | |
| 97 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title