Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dystroglycan Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Dystroglycan |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16901720
|
Novus Biologicals
NBP16901720UL |
20 μL |
Each for $152.22
|
|
NBP169017
|
Novus Biologicals
NBP169017 |
100 μL |
Each for $436.00
|
|
Description
Dystroglycan Polyclonal specifically detects Dystroglycan in Mouse samples. It is validated for Western Blot.Specifications
Dystroglycan | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
A3a, AGRNR, DAG156DAG, dystroglycan, dystroglycan 1 (dystrophin-associated glycoprotein 1), Dystrophin-associated glycoprotein 1 | |
DAG1 | |
IgG | |
Affinity Purified | |
97 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q62165 | |
1605 | |
Synthetic peptides corresponding to Dag1 (dystroglycan 1) The peptide sequence was selected from the C terminal of Dag1. Peptide sequence PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title