Learn More
Description
Specifications
Specifications
| Antigen | DZIP3 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | DAZ interacting protein 3, zinc finger, DAZ-interacting protein 3, E3 ubiquitin-protein ligase DZIP3, EC 6.3.2.-, FLJ13327, FLJ57977, FLJ58022, FLJ58223, hRUL138KIAA0675, human RNA-binding ubiquitin ligase of 138 kDa, RNA-binding ubiquitin ligase of 138 kDa, UURF2, UURF2 ubiquitin ligase, zinc finger DAZ interacting protein 3 |
| Gene Symbols | DZIP3 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESTMKTYVSKLNAETSRALTAEVYFLQCRRDFGLLHLEQTEKECLNQLARVTHMAASNLESLQLKAAVDSWNAIVADVRNKIAFLRTQYNEQINKVKQ |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
