Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 502206808

E2F1 Rabbit anti-Human, Mouse, Rat, Polyclonal, FabGennix

Catalog No. 502206808
Encompass
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
50-220-6808 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 50-220-6808 Supplier Fabgennix Inc Supplier No. E2F1101AP
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

E2F1 Polyclonal antibody specifically detects E2F1 in Human, Mouse, Rat samples. It is validated for ELISA, Immunoprecipitation, Western Blot

Specifications

Antigen E2F1
Applications ELISA, Immunoprecipitation, Western Blot
Classification Polyclonal
Concentration 0.5-1.5 mg/mL
Conjugate Unconjugated
Formulation proprietary buffer with 0.5% BSA, 30% glycerol and 0.02% sodium azide; pH 7.4-7.8
Gene E2F1
Gene Accession No. O09139, Q01094, Q61501
Gene Alias E2F transcription factor 1; E2F1; E2F-1; mKIAA4009; PBR3; PRB-binding protein E2F-1; RBAP1; RBAP-1; RBBP3; RBBP-3; RBP3; Retinoblastoma-associated protein 1; retinoblastoma-binding protein 3; Transcription factor E2F1
Host Species Rabbit
Immunogen Synthetic peptide corresponding to amino acids 58-93 of Human E2F1.Sequence:PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Purification Method Affinity chromatography
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 13555, 1869, 399489
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.