Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EAAT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | EAAT3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP162519
|
Novus Biologicals
NBP162519 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP16251920
|
Novus Biologicals
NBP16251920UL |
20 μL | Item Discontinued This item has been discontinued by the supplier. Please Sign In to view product availability in your area. | N/A | |||||
Description
EAAT3 Polyclonal specifically detects EAAT3 in Human samples. It is validated for Western Blot.Specifications
| EAAT3 | |
| Polyclonal | |
| Rabbit | |
| P43005 | |
| 6505 | |
| The immunogen for anti-SLC1A1 antibody: synthetic peptide directed towards the N terminal of human SLC1A1 (NP_004161). Peptide sequence VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EAAC1excitatory amino acid carrier 1, EAAT3excitatory amino acid transporter 3, Excitatory amino-acid carrier 1, Neuronal and epithelial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 3, solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1, Solute carrier family 1 member 1 | |
| SLC1A1 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title