Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EAAT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	EAAT3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16251920 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP16251920UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP162519 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP162519	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

EAAT3 Polyclonal specifically detects EAAT3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	EAAT3
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	P43005
Gene ID (Entrez)	6505
Immunogen	The immunogen for anti-SLC1A1 antibody: synthetic peptide directed towards the N terminal of human SLC1A1 (NP_004161). Peptide sequence VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	EAAC1excitatory amino acid carrier 1, EAAT3excitatory amino acid transporter 3, Excitatory amino-acid carrier 1, Neuronal and epithelial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 3, solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1, Solute carrier family 1 member 1
Gene Symbols	SLC1A1
Isotype	IgG
Molecular Weight of Antigen	57 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

EAAT3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents