EBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB432269	Novus Biologicals NBP18569925UL	25 μL
NBP185699	Novus Biologicals NBP185699	0.1 mL

Description

EBP Polyclonal specifically detects EBP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EBP
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10682
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: 3-beta-hydroxysteroid-Delta(8), CDPX2, Cholestenol Delta-isomerase, CPX3-beta-hydroxysteroid-delta-8, CPXDX-linked dominant (Happle syndrome), D8-D7 sterol isomerase, Delta(7)-isomerase, Delta(8)-Delta(7) sterol isomerase, delta-7-isomerase, EC 5.3.3.5, emopamil binding protein (sterol isomerase), Emopamil-binding protein, sterol 8-isomerase
• Gene Symbols: EBP
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only