Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EDEM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15996320UL
Description
EDEM1 Polyclonal specifically detects EDEM1 in Human samples. It is validated for Western Blot.Specifications
EDEM1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q92611 | |
EDEM1 | |
Synthetic peptides corresponding to EDEM1(ER degradation enhancer, mannosidase alpha-like 1) The peptide sequence was selected from the N terminal of EDEM1. Peptide sequence MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI. | |
20 μL | |
Lipid and Metabolism | |
9695 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EDEMKIAA0212ER degradation-enhancing alpha-mannosidase-like 1, ER degradation enhancer, mannosidase alpha-like 1, FLJ51559, FLJ51560 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction