Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EDEM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | EDEM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15996320
|
Novus Biologicals
NBP15996320UL |
20 μL |
Each for $152.22
|
|
NBP159963
|
Novus Biologicals
NBP159963 |
100 μL |
Each for $436.00
|
|
Description
EDEM1 Polyclonal specifically detects EDEM1 in Human samples. It is validated for Western Blot.Specifications
| EDEM1 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q92611 | |
| 9695 | |
| Synthetic peptides corresponding to EDEM1(ER degradation enhancer, mannosidase alpha-like 1) The peptide sequence was selected from the N terminal of EDEM1. Peptide sequence MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EDEMKIAA0212ER degradation-enhancing alpha-mannosidase-like 1, ER degradation enhancer, mannosidase alpha-like 1, FLJ51559, FLJ51560 | |
| EDEM1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title