Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
eEF-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154383
Description
eEF-2 Polyclonal specifically detects eEF-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
eEF-2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EF-2, EF2EEF-2, elongation factor 2, eukaryotic translation elongation factor 2, polypeptidyl-tRNA translocase | |
Rabbit | |
94 kDa | |
100 μL | |
Core ESC Like Genes, Stem Cell Markers | |
1938 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
P13639 | |
EEF2 | |
Synthetic peptides corresponding to EEF2(eukaryotic translation elongation factor 2) The peptide sequence was selected from the N terminal of EEF2. Peptide sequence TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction