EEF1A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233983

Catalog No. NBP233983

Description

EEF1A2 Polyclonal specifically detects EEF1A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EEF1A2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q05639
• Gene Symbols: EEF1A2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR
• Quantity: 0.1 mL
• Research Discipline: Cellular Signaling, Oncogenes, Transcription Factors and Regulators
• Gene ID (Entrez): 1917
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: eEF1A-2, EEF1ALFLJ41696, EF1A, EF-1-alpha-2, elongation factor 1-alpha 2, elongation factor-1 alpha, Eukaryotic elongation factor 1 A-2, eukaryotic translation elongation factor 1 alpha 2, HS1, statin, statin S1, statin-like, Statin-S1, STN, STNL
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only