Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIMA549171

Invitrogen™ EEF2 Monoclonal Antibody (5F5)
GREENER_CHOICE

Catalog No. PIMA549171
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA549171 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIMA549171 Supplier Invitrogen™ Supplier No. MA549171
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human HEPG2 whole cell, human Jurkat whole cell, human U20S whole cell, rat PC-12 whole cell, mouse NIH/3T3 whole cell. IHC: human breast cancer tissue, human rectal cancer tissue, human liver cancer tissue, human rectal cancer tissue. ICC/IF: HEPG2 cell. Flow: HEPA1-6 cell, HL-60 cell, NRK cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.
TRUSTED_SUSTAINABILITY

Specifications

Antigen EEF2
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Monoclonal
Clone 5F5
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene EEF2
Gene Accession No. P05197, P13639, P58252
Gene Alias EEF2; EEF-2; Ef2; EF-2; Elongation factor 2; elongation factor-2; eukaryotic translation elongation factor 2; I79_013848; polypeptidyl-tRNA translocase; SCA26; zef2
Gene Symbols EEF2
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence of human EEF2 (QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 13629, 1938, 29565
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.