Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EFCAB3 Antibody, Novus Biologicals™

EFCAB3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15704320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15704320 20 μL
NBP157043 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15704320 Supplier Novus Biologicals Supplier No. NBP15704320UL

Description

Rabbit Polyclonal Antibody

EFCAB3 Polyclonal specifically detects EFCAB3 in Human samples. It is validated for Western Blot.

Specifications

Antigen EFCAB3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N7B9
Gene Alias EF-hand calcium binding domain 3, EF-hand calcium-binding domain-containing protein 3, FLJ25818, MGC126801, MGC126827
Gene Symbols EFCAB3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to EFCAB3 (EF-hand calcium binding domain 3) The peptide sequence was selected from the N terminal of EFCAB3. Peptide sequence MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 146779
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.