EGR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256101

Catalog No. NBP256101

Description

EGR1 Polyclonal specifically detects EGR1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: EGR1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: AT225Transcription factor ETR103, early growth response 1, early growth response protein 1, EGR-1, G0S30, KROX24, KROX-24, Nerve growth factor-induced protein A, NGFI-ATranscription factor Zif268, TIS8, ZIF-268, Zinc finger protein Krox-24, ZNF225Zinc finger protein 225
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: EGR1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLI
• Quantity: 100 μL
• Research Discipline: Angiogenesis, Cancer, Prostate Cancer, Transcription Factors and Regulators
• Gene ID (Entrez): 1958
• Target Species: Human
• Isotype: IgG

For Research Use Only