EHD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154873

Catalog No. NBP154873

Description

EHD4 Polyclonal specifically detects EHD4 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EHD4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EH domain containing 4, EH domain-containing protein 4, EH-domain containing 4, HCA10, HCA11, Hepatocellular carcinoma-associated protein 10/11, hepatocellular carcinoma-associated protein HCA11, ortholog of rat pincher, PAST homolog 4, PAST4
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9H223
• Gene Symbols: EHD4
• Immunogen: Synthetic peptides corresponding to EHD4(EH-domain containing 4) The peptide sequence was selected from the middle region of EHD4. Peptide sequence LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 30844
• Target Species: Human, Rat, Bovine, Canine, Equine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only