Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EHF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25670525UL
Description
EHF Polyclonal specifically detects EHF in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
EHF | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
Epithelium-specific Ets transcription factor 3, ESE-3, ESE3 transcription factor, ESE3B, ESE3hEHF, ESEJepithelium-specific ets factor 3, ETS domain-containing transcription factor, ets homologous factor | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
EHF | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHL | |
25 μL | |
DNA replication Transcription Translation and Splicing | |
26298 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction