Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EID2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	EID2B
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB436328 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23804825UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP238048 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP238048	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

EID2B Polyclonal specifically detects EID2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	EID2B
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	EID-2B, EID-2-like inhibitor of differentiation 3, EID3, EID-3EID-2-like inhibitor of differentiation-3, EP300 interacting inhibitor of differentiation 2B, EP300-interacting inhibitor of differentiation 2B, FLJ38944
Gene Symbols	EID2B
Isotype	IgG
Purification Method	Affinity Purified

Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q96D98
Gene ID (Entrez)	126272
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

EID2B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents