Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EIF2 beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23848325UL
Description
EIF2 beta Polyclonal specifically detects EIF2 beta in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
EIF2 beta | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
P20042 | |
EIF2S2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK | |
25 μL | |
Core ESC Like Genes, Stem Cell Markers | |
8894 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DKFZp686L18198, EIF2, EIF2B, eIF-2-beta, EIF2beta, eukaryotic initiation factor 2-beta, eukaryotic translation initiation factor 2 beta, eukaryotic translation initiation factor 2 subunit 2, Eukaryotic translation initiation factor 2 subunit beta, eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ), eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa, MGC8508 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction