Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EIF2 beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258948
Description
EIF2 beta Polyclonal specifically detects EIF2 beta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
EIF2 beta | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
DKFZp686L18198, EIF2, EIF2B, eIF-2-beta, EIF2beta, eukaryotic initiation factor 2-beta, eukaryotic translation initiation factor 2 beta, eukaryotic translation initiation factor 2 subunit 2, Eukaryotic translation initiation factor 2 subunit beta, eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ), eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa, MGC8508 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
EIF2S2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDED | |
100 μL | |
Core ESC Like Genes, Stem Cell Markers | |
8894 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction