eIF2B epsilon Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256363

Catalog No. NBP256363

Description

eIF2B epsilon Polyclonal specifically detects eIF2B epsilon in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: eIF2B epsilon
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CACH, CLE, EIF-2B, eIF-2B GDP-GTP exchange factor subunit epsilon, EIF2BE, EIF2Bepsilon, eukaryotic translation initiation factor 2B, subunit 5 (epsilon, 82kD), eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa, LVWM, translation initiation factor eIF-2B subunit epsilon
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: EIF2B5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLL
• Quantity: 100 μL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 8893
• Target Species: Human
• Isotype: IgG

For Research Use Only