Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
eIF2B4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP324813
Description
eIF2B4 Polyclonal antibody specifically detects eIF2B4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
eIF2B4 | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
DKFZp586J0119, EIF2B, EIF-2B, eIF-2B GDP-GTP exchange factor subunit delta, EIF2BD, EIF2Bdelta, eukaryotic translation initiation factor 2B, subunit 4 (delta, 67kD), eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa, translation initiation factor eIF-2b delta subunit, translation initiation factor eIF-2B subunit delta | |
This antibody has been engineered to specifically recognize the recombinant protein eIF2B4 using the following amino acid sequence: VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER | |
100 μL | |
Endocrinology | |
8890 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction