Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EIF3S3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP184870
Description
EIF3S3 Polyclonal specifically detects EIF3S3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
EIF3S3 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500 | |
eIF-3-gamma, eIF3-gamma, eIF3h, eIF3-p40, EIF3S3eIF3 p40 subunit, Eukaryotic translation initiation factor 3 subunit 3, eukaryotic translation initiation factor 3 subunit H, eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD), eukaryotic translation initiation factor 3, subunit 3 (gamma, 40kD), eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa, eukaryotic translation initiation factor 3, subunit H, MGC102958 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
EIF3H | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN | |
0.1 mL | |
Angiogenesis, Cancer | |
8667 | |
Human, Mouse, Rat | |
IgG |
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction