eIF5A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP185943

Catalog No. NBP185943

Description

eIF5A2 Polyclonal specifically detects eIF5A2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: eIF5A2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: eIF-5A-2, EIF-5A2, eIF5AII, eukaryotic initiation factor 5A, Eukaryotic initiation factor 5A isoform 2, eukaryotic translation initiation factor 5A2, eukaryotic translation initiation factor 5A-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human eIF5A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: EIF5A2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVA
• Quantity: 0.1 mL
• Research Discipline: Cancer, Tumor Suppressors
• Gene ID (Entrez): 56648
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only