Invitrogen™ ELF1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579200

Catalog No. PIPA579200

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human COLO-320 whole cell, human A549 whole cell, human PANC-1 whole cell, Human A431 whole cell, human Jurkat whole cell, human 293T whole cell.

This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.

Specifications

• Antigen: ELF1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ELF1
• Gene Alias: E74 like ETS transcription factor 1; E74-like factor 1; E74-like factor 1 (ets domain transcription factor); ELF 1; ELF1; Elf-1; ETS-like transcription factor Elf-1-like protein; ETS-related transcription factor Elf-1; ETS-related transcription factor elf-1-like protein; mElf 1; mElf-1; OTTHUMP00000018310; p70; Sts1
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 13709, 1997, 85424
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P32519, Q60775
• Gene Symbols: ELF1
• Immunogen: A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG