Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ ELF1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579200
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579200 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579200 Supplier Invitrogen™ Supplier No. PA579200
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human COLO-320 whole cell, human A549 whole cell, human PANC-1 whole cell, Human A431 whole cell, human Jurkat whole cell, human 293T whole cell.

This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ELF1
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene ELF1
Gene Accession No. P32519, Q60775
Gene Alias E74 like ETS transcription factor 1; E74-like factor 1; E74-like factor 1 (ets domain transcription factor); ELF 1; ELF1; Elf-1; ETS-like transcription factor Elf-1-like protein; ETS-related transcription factor Elf-1; ETS-related transcription factor elf-1-like protein; mElf 1; mElf-1; OTTHUMP00000018310; p70; Sts1
Gene Symbols ELF1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 13709, 1997, 85424
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.