Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Elf4/MEF Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Elf4/MEF Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7234655 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125757 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB125757 Supplier Novus Biologicals Supplier No. NBP310428100UL

Description

Rabbit Polyclonal Antibody

Elf4/MEF Polyclonal specifically detects Elf4/MEF in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Elf4/MEF
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias E74-like factor 4, E74-like factor 4 (ets domain transcription factor), ETS-related transcription factor Elf-4, MEFELFRMyeloid Elf-1-like factor
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_062654). Peptide sequence DDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVT
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 2000
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.