ELF4 Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human ELF4.

Supplier:  Abnova Corporation PAB29473

Catalog No. 89-934-083

Description

ELF4 is a member of the ETS (see MIM 164720) gene family of transcription factors (Aryee et al., 1998 [PubMed 9524226]). ELF4 is involved in inducing cell cycle arrest in naive CD8+ T cells (Yamada et al., 2009 [PubMed 19412182]).[supplied by OMIM]

Sequence: SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVA

Specifications

• Antigen: ELF4
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant human ELF4.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Symbols: ELF4
• Immunogen: Recombinant protein corresponding to human ELF4.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:500-1:1000) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene Alias: ELFR/MEF
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 2000
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG