Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Embigin homolog Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | Embigin homolog |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Embigin homolog Polyclonal specifically detects Embigin homolog in Mouse samples. It is validated for Western Blot.Specifications
| Embigin homolog | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| embigin, embigin homolog, embigin homolog (mouse), F9, H, MGC71745 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse Embigin homolog (NP_034460.3). Peptide sequence LVAIILLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSNGIENNVPRYRKTD | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 133418 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title