Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EMC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Applications | Western Blot |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
EMC2 Polyclonal specifically detects EMC2 in Human samples. It is validated for Western Blot.Specifications
Western Blot | |
Unconjugated | |
RUO | |
9694 | |
Synthetic peptides corresponding to TTC35(tetratricopeptide repeat domain 35) The peptide sequence was selected from the middle region of TTC35. Peptide sequence IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE. | |
Primary |
Polyclonal | |
Rabbit | |
Q15006 | |
EMC2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title