Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579202

Invitrogen™ EME1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579202
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579202 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579202 Supplier Invitrogen™ Supplier No. PA579202
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, JURKAT whole cell, HUT whole cell. IHC: Rat Intestine tissue, Human Lung Cancer tissue. Flow: U20S cell.

EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication (Abraham et al., 2003).
TRUSTED_SUSTAINABILITY

Specifications

Antigen EME1
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene EME1
Gene Accession No. Q96AY2
Gene Alias 6820428D13; Crossover junction endonuclease EME1; EME1; essential meiotic endonuclease 1 homolog 1; essential meiotic endonuclease 1 homolog 1 (S. pombe); essential meiotic endonuclease 1 homolog 2; essential meiotic structure-specific endonuclease 1; hMMS4; homolog of yeast EME1 endonuclease; MMS4; MMS4 homolog; MMS4L; Msm4; SLX2 structure-specific endonuclease subunit homolog A; SLX2A
Gene Symbols EME1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 146956, 287634
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.