Invitrogen™ EME1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579202

Catalog No. PIPA579202

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, JURKAT whole cell, HUT whole cell. IHC: Rat Intestine tissue, Human Lung Cancer tissue. Flow: U20S cell.

EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication (Abraham et al., 2003).

Specifications

• Antigen: EME1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: EME1
• Gene Alias: 6820428D13; Crossover junction endonuclease EME1; EME1; essential meiotic endonuclease 1 homolog 1; essential meiotic endonuclease 1 homolog 1 (S. pombe); essential meiotic endonuclease 1 homolog 2; essential meiotic structure-specific endonuclease 1; hMMS4; homolog of yeast EME1 endonuclease; MMS4; MMS4 homolog; MMS4L; Msm4; SLX2 structure-specific endonuclease subunit homolog A; SLX2A
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 146956, 287634
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q96AY2
• Gene Symbols: EME1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG