Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EMI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | EMI1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155050
![]() |
Novus Biologicals
NBP155050 |
100 μL |
Each for $487.50
|
|
|||||
NBP15505020
![]() |
Novus Biologicals
NBP15505020UL |
20 μL | N/A | N/A | N/A | ||||
Description
EMI1 Polyclonal specifically detects EMI1 in Human samples. It is validated for Western Blot.Specifications
EMI1 | |
Polyclonal | |
Rabbit | |
Q9UKT4 | |
26271 | |
Synthetic peptides corresponding to FBXO5(F-box protein 5) The peptide sequence was selected from the C terminal of FBXO5. Peptide sequence ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EMI1Early mitotic inhibitor 1, F-box only protein 5, F-box protein 5, FBX5F-box protein Fbx5, Fbxo31 | |
FBXO5 | |
IgG | |
50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title