Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EMI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | EMI1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155050
|
Novus Biologicals
NBP155050 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15505020
|
Novus Biologicals
NBP15505020UL |
20 μL | N/A | N/A | N/A | ||||
Description
EMI1 Polyclonal specifically detects EMI1 in Human samples. It is validated for Western Blot.Specifications
| EMI1 | |
| Polyclonal | |
| Rabbit | |
| Q9UKT4 | |
| 26271 | |
| Synthetic peptides corresponding to FBXO5(F-box protein 5) The peptide sequence was selected from the C terminal of FBXO5. Peptide sequence ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EMI1Early mitotic inhibitor 1, F-box only protein 5, F-box protein 5, FBX5F-box protein Fbx5, Fbxo31 | |
| FBXO5 | |
| IgG | |
| 50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title