EMID2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP259788

Catalog No. NBP259788

Description

EMID2 Polyclonal specifically detects EMID2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EMID2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: COL26A1, EMI domain containing 2, EMI domain-containing protein 2, Emilin and multimerin domain-containing protein 2, emilin and multimerin-domain containing protein 2, EMU2, Emu2type XXVI, alpha 1, hEmu2, KIAA1299, MGC129848, putative emu2, SH2B, SH2B1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 136227
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: EMID2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acid sequence:ANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVP
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only (RUO)