EML6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23800525UL

Catalog No. NB397005

Description

EML6 Polyclonal specifically detects EML6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EML6
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q6ZMW3
• Gene Symbols: EML6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESKLVDSEESDTDVEEDG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Echinoderm Microtubule Associated Protein Like 6, Echinoderm Microtubule-Associated Protein-Like 5-Like, Echinoderm Microtubule-Associated Protein-Like 6, EMAP-6, EML5L
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 400954
• Target Species: Human
• Isotype: IgG