Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EML6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$254.42 - $728.30
Specifications
| Antigen | EML6 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
EML6 Polyclonal specifically detects EML6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EML6 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Echinoderm Microtubule Associated Protein Like 6, Echinoderm Microtubule-Associated Protein-Like 5-Like, Echinoderm Microtubule-Associated Protein-Like 6, EMAP-6, EML5L | |
| EML6 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q6ZMW3 | |
| 400954 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESKLVDSEESDTDVEEDG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title