EN-RAGE/S100A12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP186694

Catalog No. NBP186694

Description

EN-RAGE/S100A12 Polyclonal specifically detects EN-RAGE/S100A12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EN-RAGE/S100A12
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Alias: CAAF1Neutrophil S100 protein, CAGCS100 calcium binding protein A12 (calgranulin C), Calcium-binding protein in amniotic fluid 1, Calgranulin-C, CGRPEN-RAGE, ENRAGE, Extracellular newly identified RAGE-binding protein, MRP6, p6calgranulin C, protein S100-A12, S100 calcium binding protein A12, S100 calcium-binding protein A12, S100 calcium-binding protein A12 (calgranulin C)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: S100A12
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cytokine Research, Immunology, Innate Immunity, Signal Transduction
• Gene ID (Entrez): 6283
• Target Species: Human
• Isotype: IgG

For Research Use Only