Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EN1/Engrailed 1 Rabbit anti-Human, Mouse, Rat, Clone: 3B4K8, Novus Biologicals™

Rabbit Monoclonal Antibody
Supplier: Novus Biologicals NBP315852100UL
Description
EN1/Engrailed 1 Monoclonal antibody specifically detects EN1/Engrailed 1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
EN1/Engrailed 1 | |
Monoclonal | |
Unconjugated | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Western Blot | |
3B4K8 | |
Western Blot 1:500 - 1:2000 | |
engrailed homeobox 1, engrailed homolog 1, Homeobox protein en-1, homeobox protein engrailed-1, hu-En-1 | |
A synthetic peptide corresponding to a sequence within amino acids 293-392 of human EN1/Engrailed 1 (Q05925). KLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE | |
100 μg | |
Cell Biology, Neuroscience, Stem Cells | |
2019 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction