Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EN1/Engrailed 1 Rabbit anti-Human, Mouse, Rat, Clone: 3B4K8, Novus Biologicals™

EN1/Engrailed 1 Rabbit anti-Human, Mouse, Rat, Clone: 3B4K8, Novus Biologicals™
SDP

Catalog No. NB166800 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB166800 20 μg
NB166799 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB166800 Supplier Novus Biologicals Supplier No. NBP31585220UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Monoclonal Antibody

EN1/Engrailed 1 Monoclonal antibody specifically detects EN1/Engrailed 1 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

Antigen EN1/Engrailed 1
Applications Western Blot
Classification Monoclonal
Clone 3B4K8
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias engrailed homeobox 1, engrailed homolog 1, Homeobox protein en-1, homeobox protein engrailed-1, hu-En-1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 293-392 of human EN1/Engrailed 1 (Q05925). KLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cell Biology, Neuroscience, Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 2019
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.