Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EN1/Engrailed 1 Rabbit anti-Human, Mouse, Rat, Clone: 3B4K8, Novus Biologicals™

Rabbit Monoclonal Antibody

$205.50 - $458.50

Specifications

Antigen	EN1/Engrailed 1
Clone	3B4K8
Dilution	Western Blot 1:500 - 1:2000
Applications	Western Blot
Classification	Monoclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB166800 View Documents View Product Certificates	Novus Biologicals NBP31585220UL	20 μg	Each for $205.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB166799 View Documents View Product Certificates	Novus Biologicals NBP315852100UL	100 μg	Each for $458.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

EN1/Engrailed 1 Monoclonal antibody specifically detects EN1/Engrailed 1 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

Antigen	EN1/Engrailed 1
Dilution	Western Blot 1:500 - 1:2000
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	engrailed homeobox 1, engrailed homolog 1, Homeobox protein en-1, homeobox protein engrailed-1, hu-En-1
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 293-392 of human EN1/Engrailed 1 (Q05925). KLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Clone	3B4K8
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cell Biology, Neuroscience, Stem Cells
Formulation	PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez)	2019
Isotype	IgG
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

EN1/Engrailed 1 Rabbit anti-Human, Mouse, Rat, Clone: 3B4K8, Novus Biologicals™

Specifications

Description

Specifications

Documents