Enah/Vasp-like Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238132

Catalog No. NBP238132

Description

Enah/Vasp-like Polyclonal specifically detects Enah/Vasp-like in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Enah/Vasp-like
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: ena/VASP-like protein, Enah/Vasp-like, RNB6Ena/vasodilator-stimulated phosphoprotein-like
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: EVL
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SNSVEKPVSSILSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGI
• Quantity: 0.1 mL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 51466
• Target Species: Human
• Isotype: IgG