Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Endophilin A1/SH3GL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238996
Description
Endophilin A1/SH3GL2 Polyclonal specifically detects Endophilin A1/SH3GL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Endophilin A1/SH3GL2 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Q99962 | |
SH3GL2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: QEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELS | |
0.1 mL | |
Cancer | |
6456 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CNSA2FLJ25015, EEN-B1bA335L15.1 (SH3-domain GRB2-like 2), Endophilin-1, endophilin-A1, FLJ20276, SH3 domain protein 2A, SH3 domain-containing GRB2-like protein 2, SH3D2AEndophilin A1 BAR domain, SH3-domain GRB2-like 2, SH3P4endophilin-1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction