Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Endophilin B1/Bif-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP189972
Description
Endophilin B1/Bif-1 Polyclonal antibody specifically detects Endophilin B1/Bif-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).Specifications
Endophilin B1/Bif-1 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
Bax-interacting factor 1, Bif-1dJ612B15.2, CGI-61, endophilin-B1, KIAA0491endophilin B1, SH3 domain-containing GRB2-like protein B1, SH3-containing protein SH3GLB1, SH3-domain GRB2-like endophilin B1, SH3-domain, GRB2-like, endophilin B1 | |
Rabbit | |
Affinity Purified | |
RUO | |
51100 | |
Human, Mouse, Rat | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SH3GLB1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:DRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKER | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction