Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Endothelin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17947520UL
Description
Endothelin 2 Polyclonal specifically detects Endothelin 2 in Human samples. It is validated for Western Blot.Specifications
Endothelin 2 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001947 | |
EDN2 | |
Synthetic peptide directed towards the n terminal of human EDN2. Peptide sequence MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCS. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
endothelin 2, endothelin-2, ET2, ET-2, PPET2, preproendothelin 2, Preproendothelin-2 | |
Rabbit | |
20 kDa | |
20 μL | |
Signal Transduction | |
1907 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction