Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Endothelin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Endothelin 2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179475
![]() |
Novus Biologicals
NBP179475 |
100 μL |
Each for $480.74
|
|
|||||
NBP17947520
![]() |
Novus Biologicals
NBP17947520UL |
20 μL | N/A | N/A | N/A | ||||
Description
Endothelin 2 Polyclonal specifically detects Endothelin 2 in Human samples. It is validated for Western Blot.Specifications
| Endothelin 2 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| endothelin 2, endothelin-2, ET2, ET-2, PPET2, preproendothelin 2, Preproendothelin-2 | |
| EDN2 | |
| IgG | |
| 20 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001947 | |
| 1907 | |
| Synthetic peptide directed towards the n terminal of human EDN2. Peptide sequence MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title