Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Endothelin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | Endothelin 2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17947520
![]() |
Novus Biologicals
NBP17947520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179475
![]() |
Novus Biologicals
NBP179475 |
100 μL |
Each for $487.50
|
|
|||||
Description
Endothelin 2 Polyclonal specifically detects Endothelin 2 in Human samples. It is validated for Western Blot.Specifications
Endothelin 2 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
endothelin 2, endothelin-2, ET2, ET-2, PPET2, preproendothelin 2, Preproendothelin-2 | |
EDN2 | |
IgG | |
20 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_001947 | |
1907 | |
Synthetic peptide directed towards the n terminal of human EDN2. Peptide sequence MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title