Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ENKD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ENKD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ENKD1 Polyclonal specifically detects ENKD1 in Human samples. It is validated for Western Blot.Specifications
ENKD1 | |
Polyclonal | |
Rabbit | |
Q9H0I2 | |
84080 | |
Synthetic peptides corresponding to ENKD1 The peptide sequence was selected from the C terminal of ENKD1. Peptide sequence DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C16orf48, chromosome 16 open reading frame 48, DAKV6410, DKFZp434A1319, hypothetical protein LOC84080 | |
ENKD1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title