Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ENKD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310612100UL
Description
ENKD1 Polyclonal specifically detects ENKD1 in Human samples. It is validated for Western Blot.Specifications
ENKD1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C16orf48, chromosome 16 open reading frame 48, DAKV6410, DKFZp434A1319, hypothetical protein LOC84080 | |
The immunogen is a synthetic peptide directed towards the middle region of human ENKD1 (NP_115516). Peptide sequence SQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMD | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
84080 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction